PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_019808-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 126aa    MW: 14272.8 Da    PI: 7.4379
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_019808-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY72.74.8e-233592259
                   --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                   +Dg+ W+KYGqK +k+   +rsY++C  ++C++kk+ e  a+dp+ + i+Y+g Hnh+
  NNU_019808-RA 35 EDGHIWKKYGQKFIKNIGKTRSYFKCQRTDCRAKKRAEWLASDPNNLRIVYQGVHNHP 92
                   7********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.2E-232093IPR003657WRKY domain
SuperFamilySSF1182903.53E-222993IPR003657WRKY domain
PROSITE profilePS5081118.9342994IPR003657WRKY domain
SMARTSM007742.1E-223493IPR003657WRKY domain
PfamPF031064.1E-203592IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
MADPPSTTAT LLEAEEGFRE DQVVDRECTN LVMPEDGHIW KKYGQKFIKN IGKTRSYFKC  60
QRTDCRAKKR AEWLASDPNN LRIVYQGVHN HPSSTSQLSS SQQGSASVTN QYNLFTQVFG  120
DQDNPS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010276400.14e-93PREDICTED: WRKY transcription factor 44-like
TrEMBLA0A067EH105e-40A0A067EH10_CITSI; Uncharacterized protein
TrEMBLA0A067EHB37e-40A0A067EHB3_CITSI; Uncharacterized protein
TrEMBLV4TYX75e-40V4TYX7_9R
STRINGPOPTR_0001s03970.12e-35(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64000.14e-17WRKY DNA-binding protein 56